Main Page

From HYIP Rating Wiki | A Courtesy of The HYIP Project
Jump to: navigation, search




Properties Related Categories Antibodies, S Methyl L cysteine biological activity L S Methylcysteine purchase S Methyl L cysteine Prestige Antigens, Prestige Antigens C - DMore... recombinant expressed in E. coli assay >80% (SDS-PAGE) form buffered aqueous solution mol wt predicted mol wt 34 kDa purified by immobilized metal affinity chromatography (IMAC) concentration ≥0.5 mg/mL immunogen sequence ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL Ensembl | human accession no. ENSG00000173546 UniProt accession no. Q6UVK1 shipped in wet ice storage temp. −20°C Gene Information human ... CSPG4(1464) Show More (13) Description Application Suitable as a blocking agent using corresponding antibodies. General description Recombinant protein fragment of Human CSPG4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Linkage Corresponding Antibody HPA002951. Preparation Note The protein solution should be gently mixed before use. Optimal concentrations and purchase L S Methylcysteine conditions for each application should be determined by the user. Physical form Solution in 1 M urea-PBS, pH 7.4 Legal Information Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC PrEST Antigen CSPG4




Properties Related Categories Antibodies, Prestige Antigens, Prestige Antigens C - DMore... recombinant expressed in E. coli assay >80% (SDS-PAGE) form buffered aqueous solution mol wt predicted mol wt 34 kDa purified by immobilized metal affinity chromatography (IMAC) concentration ≥0.5 mg/mL immunogen sequence ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL Ensembl | human accession no. ENSG00000173546 UniProt accession no. Q6UVK1 shipped in wet ice storage temp. −20°C Gene Information human ... CSPG4(1464) Show More (13) Description Application Suitable as a blocking agent using corresponding antibodies. General description Recombinant protein fragment of Human CSPG4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Linkage Corresponding Antibody HPA002951. Preparation Note The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user. Physical form Solution in 1 M urea-PBS, pH 7.4 Legal Information Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC PrEST Antigen CSPG4




Properties Related Categories Antibodies, Prestige Antigens, Prestige Antigens C - DMore... recombinant expressed in E. coli assay >80% (SDS-PAGE) form buffered aqueous solution mol wt predicted mol wt 34 kDa purified by immobilized metal affinity chromatography (IMAC) concentration ≥0.5 mg/mL immunogen sequence ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL Ensembl | human accession no. ENSG00000173546 UniProt accession no. Q6UVK1 shipped in wet ice storage temp. −20°C Gene Information human ... CSPG4(1464) Show More (13) Description Application Suitable as a blocking agent using corresponding antibodies. General description Recombinant protein fragment of Human CSPG4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Optimal concentrations and conditions for each application should be determined by the user. Physical form Solution in 1 M urea-PBS, pH 7.4 Legal Information Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC PrEST Antigen CSPG4




Properties Related Categories Antibodies, Prestige Antigens, Prestige Antigens C - DMore... recombinant expressed in E. coli assay >80% (SDS-PAGE) form buffered aqueous solution mol wt predicted mol wt 34 kDa purified by immobilized metal affinity chromatography (IMAC) concentration ≥0.5 mg/mL immunogen sequence ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL Ensembl | human accession no.